missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35499-20ul
This item is not returnable.
View return policy
Description
TBL1 Polyclonal antibody specifically detects TBL1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| TBL1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EBI, SMAP55, TBL1transducin (beta)-like 1, transducin (beta)-like 1X-linked, X-linked | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TBL1 (NP_005638.1).,, Sequence:, LISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEEN | |
| 20 μL | |
| Wnt Signaling Pathway | |
| 6907 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction