missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STRA6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | STRA6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
STRA6 Polyclonal specifically detects STRA6 in Human samples. It is validated for Western Blot.Specifications
| STRA6 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ12541, MCOPS9, stimulated by retinoic acid gene 6 homolog (mouse), stimulated by retinoic acid gene 6 protein homolog | |
| STRA6 | |
| IgG | |
| 73 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BX79 | |
| 64220 | |
| Synthetic peptides corresponding to STRA6(stimulated by retinoic acid gene 6 homolog (mouse)) The peptide sequence was selected from the N terminal of STRA6 (NP_071764). Peptide sequence MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title