missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STK35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | STK35 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
STK35 Polyclonal specifically detects STK35 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| STK35 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 140901 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| bA550O8.2, CLIK-1, CLIK1Serine/threonine-protein kinase 35 L1, CLP-36 interacting kinase, CLP-36-interacting kinase 1, EC 2.7.11, EC 2.7.11.1, PDIK1, PDLIM1-interacting kinase 1, serine threonine kinase 35 long form, serine/threonine kinase 35, serine/threonine-protein kinase 35, STK35L1 | |
| STK35 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title