missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSTK-IP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33923-25ul
This item is not returnable.
View return policy
Description
SSTK-IP Polyclonal antibody specifically detects SSTK-IP in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| SSTK-IP | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Q96A04 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 128229 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| C1orf182, chromosome 1 open reading frame 182, MGC26877, RP11-443G18.5, SIP, SSTK-interacting protein (SSTK-IP), SSTK-IP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLG | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction