missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SREBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54707
This item is not returnable.
View return policy
Description
SREBP1 Polyclonal specifically detects SREBP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SREBP1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| BHLHD1, Class D basic helix-loop-helix protein 1, SREBP 1c, SREBP-1, SREBP1bHLHd1SREBP-1c, sterol regulatory element binding protein-1, sterol regulatory element binding transcription factor 1, sterol regulatory element-binding protein 1, Sterol regulatory element-binding transcription factor 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| SREBF1 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:SLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAI | |
| 100 μL | |
| Cancer, Cholesterol Metabolism, Chromatin Research, Diabetes Research, Lipid and Metabolism, Transcription Factors and Regulators | |
| 6720 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction