missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RELT/TNFRSF19L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57601
This item is not returnable.
View return policy
Description
RELT/TNFRSF19L Polyclonal specifically detects RELT/TNFRSF19L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| RELT/TNFRSF19L | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| Receptor expressed in lymphoid tissues, RELT tumor necrosis factor receptor, TNFRSF19LFLJ14993, tumor necrosis factor receptor superfamily member 19L, tumor necrosis factor receptor superfamily, member 19-like | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RELT | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSE | |
| 100 μL | |
| Cancer | |
| 84957 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction