missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sorting Nexin 32 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93723-0.02ml
This item is not returnable.
View return policy
Description
Sorting Nexin 32 Polyclonal antibody specifically detects Sorting Nexin 32 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| Sorting Nexin 32 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| DKFZp761P1320, FLJ30934, MGC42112, MGC57276, SNX6B, sorting nexin 32, sorting nexin 6B, sorting nexin-32, Sorting nexin-6B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 218-285 of human Sorting Nexin 32 (NP_689973.2). HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDE | |
| 0.02 mL | |
| Signal Transduction | |
| 254122 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction