missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94614-0.02ml
This item is not returnable.
View return policy
Description
Sodium Potassium ATPase Alpha 4 Polyclonal antibody specifically detects Sodium Potassium ATPase Alpha 4 in Mouse, Rat samples. It is validated for Western Blot
Specifications
| Sodium Potassium ATPase Alpha 4 | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| ATP1A1, ATP1AL2Na+/K+ ATPase, alpha-D polypeptide, ATPase, Na+/K+ transporting, alpha 4 polypeptide, ATPase, Na+/K+ transporting, alpha polypeptide-like 2, EC 3.6.3, EC 3.6.3.9, K-ATPase subunit alpha-C, MGC25056, Na, Na(+)/K(+) ATPase alpha-4 subunit, Na+/K+ ATPase 4, sodium pump 4, Sodium pump subunit alpha-4, sodium/potassium-transporting ATPase alpha-4 chain, sodium/potassium-transporting ATPase subunit alpha-4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2). MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGPNTVTP | |
| 0.02 mL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 480 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction