missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
201.00€ - 470.00€
Specifications
| Antigen | Sodium Calcium Exchanger 1/NCX1 |
|---|---|
| Dilution | Western Blot 1:2000 - 1:6000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18639941
|
Novus Biologicals
NBP2-94316-0.02ml |
0.02 mL |
201.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18630032
|
Novus Biologicals
NBP2-94316-0.1ml |
0.1 mL |
470.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Sodium Calcium Exchanger 1/NCX1 Polyclonal antibody specifically detects Sodium Calcium Exchanger 1/NCX1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Sodium Calcium Exchanger 1/NCX1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 6546 | |
| IgG | |
| Affinity purified |
| Western Blot 1:2000 - 1:6000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FLJ37694, FLJ43417, Na(+)/Ca(2+)-exchange protein 1, sodium/calcium exchanger 1, solute carrier family 8 (sodium/calcium exchanger), member 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human Sodium Calcium Exchanger 1/NCX1 (NP_066920.1). DEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title