missing translation for 'onlineSavingsMsg'
Learn More

Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. p-200062293 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18639941 0.02 mL 0.02mL
18630032 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18639941 Supplier Novus Biologicals Supplier No. NBP2943160.02ml

Please to purchase this item. Need a web account? Register with us today!

This item has been discontinued and is no longer available. View the product for possible alternatives or contact our Technical Support team on +351 21 425 33 50 for assistance
View alternative products

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Sodium Calcium Exchanger 1/NCX1 Polyclonal antibody specifically detects Sodium Calcium Exchanger 1/NCX1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Sodium Calcium Exchanger 1/NCX1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:2000 - 1:6000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias FLJ37694, FLJ43417, Na(+)/Ca(2+)-exchange protein 1, sodium/calcium exchanger 1, solute carrier family 8 (sodium/calcium exchanger), member 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human Sodium Calcium Exchanger 1/NCX1 (NP_066920.1). DEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Endocrinology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6546
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.