missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SNIP1 Polyclonal antibody specifically detects SNIP1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | SNIP1 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | dJ423B22.2, FHA domain-containing protein SNIP1, FLJ12553, RP3-423B22.3, Smad nuclear interacting protein (SNIP1), Smad nuclear interacting protein 1, smad nuclear-interacting protein 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SNIP1 (NP_078976.2). SESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?