missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SNCA Recombinant Protein

335.00€ - 508.00€

Specifications

Accession Number AAH13293.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 6622
Molecular Weight (g/mol) 41.1
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16190862
View Documents Promotion Details
Abnova™
H00006622-P01.10UG
10 ug
335.00€
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-08-2024
to see stock.
Add to basket
 
16100872
View Documents Promotion Details
Abnova™
H00006622-P01.25UG
25 ug
508.00€
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-08-2024
to see stock.
Add to basket
 
Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH13293.1
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
41.1
8
Glutathione Sepharose 4 Fast Flow
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SNCA
Human
Recombinant
Solution
Antibody Production, Protein Array, ELISA, Western Blot
6622
SNCA (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
MGC110988/NACP/PARK1/PARK4/PD1
SNCA
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Product Certifications