missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SNCA Recombinant Protein
Brand: Abnova™ H00006622-P01.10ug
Additional Details : Weight : 0.00010kg
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH13293.1 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
41.1 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA | |
MGC110988/NACP/PARK1/PARK4/PD1 | |
SNCA | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
6622 | |
SNCA (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SNCA | |
Human | |
Recombinant | |
Solution |