missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC4A10 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94675-0.1ML
This item is not returnable.
View return policy
Description
SLC4A10 Polyclonal antibody specifically detects SLC4A10 in Human, Mouse samples. It is validated for Western Blot
Specifications
| SLC4A10 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| sodium bicarbonate cotransporter-like, member 10, sodium bicarbonate transporter-like, member 10, sodium-driven chloride bicarbonate exchanger, Solute carrier family 4 member 10, solute carrier family 4, sodium bicarbonate transporter, member 10 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 640-725 of human SLC4A10 (NP_001171486.1). ALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHPYVPDV | |
| 0.1 mL | |
| Neuroscience | |
| 57282 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction