missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18203313

SLC37A4 Antibody, Novus Biologicals™

Product Code. 18203313 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18203313 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18203313 Supplier Novus Biologicals Supplier No. NBP159877

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SLC37A4 Polyclonal specifically detects SLC37A4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC37A4
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O43826
Gene Alias G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19
Gene Symbols SLC37A4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC37A4(solute carrier family 37 (glucose-6-phosphate transporter), member 4) The peptide sequence was selected from the N terminal of SLC37A4. Peptide sequence LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 46 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2542
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.