missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC35D3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94451-0.02ml
This item is not returnable.
View return policy
Description
SLC35D3 Polyclonal antibody specifically detects SLC35D3 in Human samples. It is validated for Western Blot
Specifications
| SLC35D3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| bA55K22.3, frc, fringe-like 1, FRCL1, Fringe connection-like protein 1, MGC102873, solute carrier family 35 member D3, solute carrier family 35, member D3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 310-390 of human SLC35D3 (NP_001008783.1). NYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYL | |
| 0.02 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 340146 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction