missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC30A7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93360-0.02ml
This item is not returnable.
View return policy
Description
SLC30A7 Polyclonal antibody specifically detects SLC30A7 in Human samples. It is validated for Western Blot
Specifications
| SLC30A7 | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| DKFZp686M0368, solute carrier family 30 (zinc transporter), member 7, Solute carrier family 30 member 7, zinc transporter like 2, zinc transporter ZnT-7, ZnT-7, ZNT7zinc transporter 7, ZnTL2, Znt-like transporter 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 287-376 of human SLC30A7 (NP_598003.2). RESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFTQAGVRQLYVQIDFAAM | |
| 0.02 mL | |
| Endocrinology, Signal Transduction | |
| 148867 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction