missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC28A3 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93439-0.02ml
This item is not returnable.
View return policy
Description
SLC28A3 Polyclonal antibody specifically detects SLC28A3 in Human samples. It is validated for Western Blot
Specifications
| SLC28A3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CNT 3, CNT3concentrative Na+-nucleoside cotransporter, Concentrative Na(+)-nucleoside cotransporter 3, hCNT3, solute carrier family 28 (sodium-coupled nucleoside transporter), member 3, solute carrier family 28 member 3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 612-691 of human SLC28A3 (NP_071410.1). LSSTPVDINCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNTF | |
| 0.02 mL | |
| Cancer | |
| 64078 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction