missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC26A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
487.00€
Specifications
| Antigen | SLC26A1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SLC26A1 Polyclonal specifically detects SLC26A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC26A1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EDM4, SAT1, SAT-1sulfate anion transporter 1, solute carrier family 26 (sulfate transporter), member 1, Solute carrier family 26 member 1, sulfate anion tranporter AT1, sulfate transporter, sulfate/anion transporter SAT-1 protein | |
| SLC26A1 | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Q9H2B4 | |
| 10861 | |
| Synthetic peptides corresponding to SLC26A1(solute carrier family 26 (sulfate transporter), member 1) The peptide sequence was selected from the C terminal of SLC26A1. Peptide sequence LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title