missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC24A6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00€ - 624.00€
Specifications
| Antigen | SLC24A6 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18497680
|
Novus Biologicals
NBP1-83607-25ul |
25 μL |
292.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18719803
|
Novus Biologicals
NBP1-83607 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC24A6 Polyclonal specifically detects SLC24A6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC24A6 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 80024 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ22233, NCKX6Na(+)/K(+)/Ca(2+)-exchange protein 6, NCLX, sodium/potassium/calcium exchanger 6, solute carrier family 24 (sodium/potassium/calcium exchanger), member 6, Solute carrier family 24 member 6 | |
| SLC24A6 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title