missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC13A4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94853-0.1ml
This item is not returnable.
View return policy
Description
SLC13A4 Polyclonal antibody specifically detects SLC13A4 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| SLC13A4 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Na(+)/sulfate cotransporter SUT-1, NaS2, solute carrier family 13 (sodium/sulfate symporters), member 4, solute carrier family 13 (sodium/sulphate symporters), member 4, sulphate transporter 1, SUT-1, SUT1solute carrier family 13 member 4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 390-465 of human SLC13A4 (NP_036582.2). WFTREPGFVPGWDSFFEKKGYRTDATVSVFLGFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWE | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 26266 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction