missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SIRT7 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33378-100ul
This item is not returnable.
View return policy
Description
SIRT7 Monoclonal antibody specifically detects SIRT7 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| SIRT7 | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| EC 3.5.1.-, MGC126840, MGC126842, silent mating type information regulation 2, S.cerevisiae, homolog 7, SIR2L7NAD-dependent deacetylase sirtuin-7, SIR2-like protein 7, sir2-related protein type 7, sirtuin (silent mating type information regulation 2 homolog) 7 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7, sirtuin 7, sirtuin type 7 | |
| A synthetic peptide corresponding to a sequence within amino acids 301-400 of human SIRT7 (NP_057622.1).,, Sequence:, TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT | |
| 100 μL | |
| DNA Repair, Epigenetics | |
| 51547 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction