missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Septin-8 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93880-0.1ml
This item is not returnable.
View return policy
Description
Septin-8 Polyclonal antibody specifically detects Septin-8 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Septin-8 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| KIAA0202SEP2, septin 8, septin-8 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 348-427 of human Septin-8 (NP_001287728.1). NKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKKN | |
| 0.1 mL | |
| Stem Cell Markers | |
| 23176 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction