missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SEC23IP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | SEC23IP |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18271483
|
Novus Biologicals
NBP2-58361 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18602069
|
Novus Biologicals
NBP2-58361-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SEC23IP Polyclonal specifically detects SEC23IP in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Specifications
| SEC23IP | |
| Polyclonal | |
| Rabbit | |
| Golgi Apparatus Markers | |
| P125, P125A, SEC23 interacting protein, SEC23-interacting protein | |
| SEC23IP | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown | |
| Unconjugated | |
| RUO | |
| Human | |
| 11196 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title