missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SEC14L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 572.00€
Specifications
| Antigen | SEC14L1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18129577
|
Novus Biologicals
NBP2-38133 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667015
|
Novus Biologicals
NBP2-38133-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SEC14L1 Polyclonal specifically detects SEC14L1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SEC14L1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686C06176, PRELID4A, SEC14L, SEC14-like 1 (S. cerevisiae), SEC14-like protein 1 | |
| SEC14L1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q92503 | |
| 6397 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITPSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title