missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCYL1BP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | SCYL1BP1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry (Paraffin), Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SCYL1BP1 Polyclonal specifically detects SCYL1BP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SCYL1BP1 | |
| Immunohistochemistry (Paraffin), Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 92344 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLME | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ11752, golgin, RAB6-interacting, GONTKL-binding protein 1, hNTKL-BP1, MGC51263, MGC70512, N-terminal kinase-like-binding protein 1, NTKL-BP1, NTKLBP1SCY1-like 1-binding protein 1, RAB6-interacting golgin, SCY1-like 1 binding protein 1, SCYL1-BP1, SCYL1BP1SCYL1-binding protein 1 | |
| GORAB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title