missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Schlafen 11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
271.00€ - 547.00€
Specifications
| Antigen | Schlafen 11 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18701704
|
Novus Biologicals
NBP1-92368 |
0.1 mL |
547.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18432861
|
Novus Biologicals
NBP1-92368-25ul |
25 μL |
271.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Schlafen 11 Polyclonal specifically detects Schlafen 11 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Schlafen 11 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ34922, schlafen family member 11 | |
| SLFN11 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 91607 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title