missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SC65 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
196.00€ - 468.00€
Specifications
| Antigen | SC65 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SC65 Polyclonal antibody specifically detects SC65 in Human, Rat samples. It is validated for Western BlotSpécification
| SC65 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.3), 50% glycerol | |
| 10609 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| leprecan-like 4, Leprecan-like protein 4, NO55, 55kDa, NOL55, Nucleolar autoantigen No55, SC65rat synaptonemal complex protein, synaptonemal complex protein SC65 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 338-437 of human P3H4 (NP_006446.1). FHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit