missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAP30BP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38685-25ul
This item is not returnable.
View return policy
Description
SAP30BP Polyclonal specifically detects SAP30BP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| SAP30BP | |
| Polyclonal | |
| Western Blot 1:100 - 1:250, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9UHR5 | |
| SAP30BP | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HCNGPDKFZp586L2022, HTRGHSV-1 binding, HTRPSAP30-binding protein, SAP30 binding protein, Transcriptional regulator protein HCNGP | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 29115 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido