missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAP102 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | SAP102 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18252094
|
Novus Biologicals
NBP2-58864 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18652127
|
Novus Biologicals
NBP2-58864-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SAP102 Polyclonal specifically detects SAP102 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| SAP102 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Neuroscience | |
| discs, large homolog 3 (Drosophila), KIAA1232discs, large homolog 3 (neuroendocrine-dlg, Drosophila), MRX90MRX, NEDLGdisks large homolog 3, neuroendocrine-DLG, SAP-102, SAP102NE-Dlg, Synapse-associated protein 102, XLMR | |
| DLG3 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1741 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('HLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHK',) | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title