missing translation for 'onlineSavingsMsg'
Learn More
Learn More
S1P1/EDG-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | S1P1/EDG-1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18232492
|
Novus Biologicals
NBP2-58024 |
100 μL |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18694188
|
Novus Biologicals
NBP2-58024-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
S1P1/EDG-1 Polyclonal specifically detects S1P1/EDG-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| S1P1/EDG-1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cytoskeleton Markers, GPCR, Lipid and Metabolism, Neuroscience, Signal Transduction | |
| CD363, CD363 antigen, CHEDG1, D1S3362, EDG-1, EDG1edg-1, Endothelial differentiation G-protein coupled receptor 1, endothelial differentiation, sphingolipid G-protein-coupled receptor, 1, FLJ58121, S1P receptor 1, S1P receptor Edg-1, s1p1, S1P1ECGF1, sphingosine 1-phosphate receptor 1, sphingosine 1-phosphate receptor EDG1, Sphingosine 1-phosphate receptor Edg-1, sphingosine-1-phosphate receptor 1 | |
| S1PR1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1901 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title