missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ S100A12 (Human) Recombinant Protein

Human S100A12 full-length ORF ( NP_005612.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00006283-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16102518

  • 335.00€ / 10µg
Estimated Shipment: 04-07-2024
to see stock.
Add to basket

Description

Description

  • Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Specifications

Specifications

NP_005612.1
S100 calcium binding protein A12
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
S100A12
GST
6283
Wheat germ expression system
10 μg
CAAF1, CAGC, CGRP, ENRAGE, MRP6, p6
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers