missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RXFP3/RLN3R1/SALPR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | RXFP3/RLN3R1/SALPR |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RXFP3/RLN3R1/SALPR Polyclonal specifically detects RXFP3/RLN3R1/SALPR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RXFP3/RLN3R1/SALPR | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| G protein-coupled receptor SALPR, GPCR135MGC141998, G-protein coupled receptor SALPR, relaxin 3 receptor 1, Relaxin family peptide receptor 3RLN3 receptor 1, relaxin/insulin-like family peptide receptor 3, relaxin-3 receptor 1, RLN3R1MGC142000, RXFPR3, SALPRG-protein coupled receptor GPCR135, somatostatin and angiotensin-like peptide receptor, Somatostatin- and angiotensin-like peptide receptor | |
| RXFP3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51289 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title