missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RWDD4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 540.75€
Specifications
| Antigen | RWDD4A |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18606615
|
Novus Biologicals
NBP2-38304-25ul |
25 μL |
415.00€ 391.65€ / 25µL Save 23.35€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18147457
|
Novus Biologicals
NBP2-38304 |
0.1 mL |
572.00€ 540.75€ / 0.10mL Save 31.25€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RWDD4A Polyclonal specifically detects RWDD4A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| RWDD4A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A | |
| RWDD4 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q6NW29 | |
| 201965 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TYTLFEYAKDNKEQFMENHNPINSATSISNIISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel