missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Rubicon Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49134-25ul
This item is not returnable.
View return policy
Description
Rubicon Polyclonal antibody specifically detects Rubicon in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Rubicon | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Baron, Beclin 1-interacting protein, Beclin-1 Associated RUN Domain Containing Protein, KIAA0226, Rubicon, RUN And Cysteine Rich Domain Containing Beclin 1 Interacting Protein, RUN Domain And Cysteine-Rich Domain Containing, Beclin 1-Interacting Protein, Run Domain Beclin-1-Interacting And Cysteine-Rich Domain-Containing Protein, rundataxin, SCAR15 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFS | |
| 25 μL | |
| Autophagy, Cancer, Cardiovascular Biology, Cell Biology, Endocrinology, Signal Transduction | |
| 9711 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction