missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35496-20ul
This item is not returnable.
View return policy
Description
RPL6 Polyclonal antibody specifically detects RPL6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| RPL6 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| DNA-binding protein TAXREB107, Neoplasm-related protein C140, ribosomal protein L6,60S ribosomal protein L6, SHUJUN-2, TaxREB107, Tax-responsive enhancer element-binding protein 107, TXREB1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 188-288 of human RPL6 (NP_000961.2).,, Sequence:, RTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQLQGYLRSVFALTNGIYPHKLVF | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6128 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction