missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ROR alpha/NR1F1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-52813
This item is not returnable.
View return policy
Description
ROR alpha/NR1F1 Polyclonal specifically detects ROR alpha/NR1F1 in Human, Rat samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.
Specifications
| ROR alpha/NR1F1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp686M2414, MGC119326, NR1F1MGC119329, nuclear receptor ROR-alpha, Nuclear receptor RZR-alpha, Nuclear receptor subfamily 1 group F member 1, RAR-related orphan receptor A, RAR-related orphan receptor alpha, retinoic acid receptor-related orphan receptor alpha, retinoid-related orphan receptor alpha, Retinoid-related orphan receptor-alpha, ROR1, ROR2, ROR3, RZR-ALPHA, RZRAROR-alpha, transcription factor RZR-alpha | |
| Rabbit | |
| 63 kDa | |
| 100 μL | |
| GPCR | |
| 6095 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence 1:10-1:2000, Immunohistochemistry-Paraffin | |
| P35398 | |
| RORA | |
| Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC. | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Sheep: 86%. | |
| Human, Rat, Bovine, Canine, Equine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction