missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF213 Antibody (5C12), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00057674-M01
This item is not returnable.
View return policy
Description
RNF213 Monoclonal antibody specifically detects RNF213 in Human samples. It is validated for Western Blot, ELISA
Specifications
| RNF213 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA | |
| 5C12 | |
| Western Blot, ELISA | |
| ALK lymphoma oligomerization partner on chromosome 17, C17orf27, chromosome 17 open reading frame 27, DKFZp762N1115, FLJ13051, KIAA1554MGC46622, KIAA1618, MGC9929, NET57, protein ALO17, ring finger protein 213 | |
| C17orf27 (NP_065965, 2016 a.a. ∽ 2112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE | |
| 0.1 mg | |
| Zinc Finger | |
| 57674 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction