missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RND3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
426.00€ - 624.00€
Specifications
| Antigen | RND3 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18636828
|
Novus Biologicals
NBP2-49315-25ul |
25 μL |
426.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18656626
|
Novus Biologicals
NBP2-49315 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
RND3 Polyclonal antibody specifically detects RND3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| RND3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 390 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ARHE, Protein MemB, Rho family GTPase 3member E, RHO8, RHOE, Rho-related GTP-binding protein Rho8, rho-related GTP-binding protein RhoE, Rnd3, small GTP binding protein Rho8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts