missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 18709193

Novus Biologicals™ Recombinant Human VAMP3/Cellubrevin Protein

Product Code. 18709193 Shop All Bio Techne Products
Change view
Click to view available options
:
0.1mg; Unlabeled
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code.
18709193 0.1mg; Unlabeled
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18709193 Supplier Novus Biologicals™ Supplier No. NBC118346

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-77 of Human VAMP3/Cellubrevin The Recombinant Human VAMP3/Cellubrevin Protein is derived from E. coli. The Recombinant Human VAMP3/Cellubrevin Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number NP_004772
For Use With (Application) Western Blot
Formulation 20mM Tris-HCl buffer (pH 7.5), 10% glycerol
Gene ID (Entrez) 9341
Molecular Weight (g/mol) 8.7kDa
Name VAMP3/Cellubrevin Protein
Purification Method Protein
Immunogen MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.