Learn More
Abnova™ RBP4 Recombinant Protein
Description
This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells
- Theoretical MW (kDa): 45.87
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Specifications
| Accession Number | AAH20633.1 |
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gene ID (Entrez) | 5950 |
| Molecular Weight (g/mol) | 45.87 |
| Name | RBP4 (Human) Recombinant Protein (P01) |
| pH Range | 8 |
| Preparation Method | In vitro wheat germ expression system |
| Purification Method | Glutathione Sepharose 4 Fast Flow |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.