missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBMS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€
Specifications
| Antigen | RBMS2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBMS2 Polyclonal specifically detects RBMS2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RBMS2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ39093, FLJ40023, RNA binding motif, single stranded interacting protein 2, RNA-binding motif, single-stranded-interacting protein 2, SCR3FLJ43262, Suppressor of CDC2 with RNA-binding motif 3 | |
| RBMS2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5939 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title