missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RASD2 Recombinant Protein

Brand:  Abnova™ H00023551-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16107452

  • 508.00€ / 25µg
Estimated Shipment: 18-07-2024
to see stock.
Add to basket

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH13419
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
55
8
Glutathione Sepharose 4 Fast Flow
25 ug
MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIGSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
MGC:4834/Rhes/TEM2
RASD2
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
23551
RASD2 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RASD2
Human
Recombinant
Solution
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Produktzertifizierungen
Sonderangebote

Sonderangebote