missing translation for 'onlineSavingsMsg'
Learn More

C9orf91, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant C9orf91.

Brand: Abnova PAB21144.100uL

Additional Details : Weight : 0.02000kg

Product Code. 16174080

Quantity
Estimated Shipment
26-09-2019

Add to basket

Description

Sequence: SVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTSQ

Specifications

Antigen	C9orf91
Conjugate	Unconjugated
Dilution	Immunohistochemistry (1:500-1:1000) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Gene	C9orf91
Format	Liquid
Gene Symbols	C9orf91
Immunogen	Recombinant protein corresponding to amino acids of human C9orf91.
Purification Method	Antigen affinity purification
Regulatory Status	RUO
Primary or Secondary	Primary
Gene ID (Entrez)	203197

Applications	Immunohistochemistry (PFA fixed), Western Blot
Description	Rabbit polyclonal antibody raised against recombinant C9orf91.
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Accession No.	Q5VZI3
Gene Alias	DKFZp547P234\|FLJ38045\|MGC129868\|MGC129869\|RP11-402G3.2
Host Species	Rabbit
Isotype	IgG
Quantity	100 uL
Storage Requirements	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Monoclonal or Polyclonal	Polyclonal
Target Species	Human

For Research Use Only

Description