missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Rab3C Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00€ - 507.00€
Specifications
| Antigen | Rab3C |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232476
|
Novus Biologicals
NBP3-33517-100ul |
100 μL |
507.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232118
|
Novus Biologicals
NBP3-33517-20ul |
20 μL |
213.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Rab3C Monoclonal antibody specifically detects Rab3C in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| Rab3C | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Membrane Trafficking and Chaperones, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 115827 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| RAB3C, member RAS oncogene family, ras-related protein Rab-3C | |
| A synthetic peptide corresponding to a sequence within amino acids 128-227 of human Rab3C (NP_612462.1).,, Sequence:, IKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title