missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTTG1IP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€
Specifications
| Antigen | PTTG1IP |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PTTG1IP Polyclonal specifically detects PTTG1IP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PTTG1IP | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C21orf1putative surface glycoprotein C21orf1 precursor10C21orf3pituitary tumor-transforming gene 1 protein-interacting protein, PBFPTTG-binding factor, pituitary tumor-transforming 1 interacting protein, Pituitary tumor-transforming gene protein-binding factor | |
| PTTG1IP | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 754 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title