missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTTG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46709-25ul
This item is not returnable.
View return policy
Description
PTTG1 Polyclonal antibody specifically detects PTTG1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| PTTG1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| O95997 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| EAP1MGC126883, Esp1-associated protein, ESP1-associated protein 1, hPTTG, pituitary tumor-transforming 1, Pituitary tumor-transforming gene 1 protein, PTTGMGC138276, securin, Tumor-transforming protein 1, TUTR1HPTTG | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA | |
| 25 μL | |
| Breast Cancer, Cell Cycle and Replication, Mitotic Regulators | |
| 9232 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Ser du en mulighed for forbedring?Del en indholdskorrektion