missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTTG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46709
This item is not returnable.
View return policy
Description
PTTG1 Polyclonal antibody specifically detects PTTG1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| PTTG1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| O95997 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| EAP1MGC126883, Esp1-associated protein, ESP1-associated protein 1, hPTTG, pituitary tumor-transforming 1, Pituitary tumor-transforming gene 1 protein, PTTGMGC138276, securin, Tumor-transforming protein 1, TUTR1HPTTG | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA | |
| 0.1 mL | |
| Breast Cancer, Cell Cycle and Replication, Mitotic Regulators | |
| 9232 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction