missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTOV1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79384
This item is not returnable.
View return policy
Description
PTOV1 Polyclonal specifically detects PTOV1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PTOV1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ACID2, Activator interaction domain-containing protein 2, DKFZp586I111, MGC71475, prostate tumor overexpressed 1, prostate tumor overexpressed gene 1, PTOV-1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 53635 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin | |
| NP_059128 | |
| PTOV1 | |
| Synthetic peptide directed towards the N terminal of human PTOV1The immunogen for this antibody is PTOV1. Peptide sequence DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction