missing translation for 'onlineSavingsMsg'
Learn More

PTOV1 Antibody, Novus Biologicals™

Product Code. 18278255 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18278255 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18278255 Supplier Novus Biologicals Supplier No. NBP179384

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PTOV1 Polyclonal specifically detects PTOV1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PTOV1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_059128
Gene Alias ACID2, Activator interaction domain-containing protein 2, DKFZp586I111, MGC71475, prostate tumor overexpressed 1, prostate tumor overexpressed gene 1, PTOV-1
Gene Symbols PTOV1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human PTOV1The immunogen for this antibody is PTOV1. Peptide sequence DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 53635
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.