missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proteasome 20S beta2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00€
Specifications
| Antigen | Proteasome 20S beta2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Proteasome 20S beta2 Polyclonal specifically detects Proteasome 20S beta2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Proteasome 20S beta2 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| EC 3.4.25.1, HC7-I, Macropain subunit C7-I, MGC104215, MGC126885, multicatalytic endopeptidase complex subunit C7-1, Multicatalytic endopeptidase complex subunit C7-I, proteasome (prosome, macropain) subunit, beta type, 2, proteasome beta 2 subunit, Proteasome component C7-I, proteasome subunit beta type-2, proteasome subunit, beta type, 2 | |
| PSMB2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Proteasome 20S beta2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Proteases & Other Enzymes | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5690 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTF | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title