missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proteasome 20S beta 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | Proteasome 20S beta 3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Proteasome 20S beta 3 Polyclonal specifically detects Proteasome 20S beta 3 in Human samples. It is validated for Western Blot.Specifications
| Proteasome 20S beta 3 | |
| Polyclonal | |
| Rabbit | |
| P49720 | |
| 5691 | |
| Synthetic peptides corresponding to PSMB3(proteasome (prosome, macropain) subunit, beta type, 3) The peptide sequence was selected from the middle region of PSMB3. Peptide sequence LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF. | |
| Primary | |
| 23 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4.25.1, HC10-II, MGC4147, proteasome (prosome, macropain) subunit, beta type, 3, Proteasome chain 13, Proteasome component C10-II, proteasome subunit beta type-3, Proteasome theta chain | |
| PSMB3 | |
| IgG | |
| This product is specific to Subunit or Isoform: beta type-3. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title